Iright
BRAND / VENDOR: Proteintech

Proteintech, 11430-2-AP, Serpin A4/Kallistatin Polyclonal antibody

CATALOG NUMBER: 11430-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Serpin A4/Kallistatin (11430-2-AP) by Proteintech is a Polyclonal antibody targeting Serpin A4/Kallistatin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11430-2-AP targets Serpin A4/Kallistatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human spleen tissue, human plasma tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kallistatin is also named Serpin A4 and Peptidase inhibitor 4 (PI-4). Kallistatin was first identified in human plasma as a tissue kallikrein-binding protein and a serine proteinase inhibitor. Kallistatin via its two structural elements regulates differential signaling cascades, and thus a wide spectrum of biological functions (PMID: 28427524). Kallistatin via the active site promotes neovascularization by stimulating VEGF levels in endothelial progenitor cells. Second, kallistatin inhibits or induces apoptosis depending on cell types. Kallistatin via its heparin-binding site inhibits angiogenesis by blocking vascular endothelial growth factor (VEGF)-induced growth, migration and adhesion of endothelial cells. Kallistatin can act as an antioxidant or pro-oxidant (PMID: 28742513). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1962 Product name: Recombinant human SERPINA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-427 aa of BC014992 Sequence: QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC014992 Gene Symbol: Kallistatin Gene ID (NCBI): 5267 RRID: AB_2185735 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924