Iright
BRAND / VENDOR: Proteintech

Proteintech, 11447-2-AP, GTF3C5 Polyclonal antibody

CATALOG NUMBER: 11447-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GTF3C5 (11447-2-AP) by Proteintech is a Polyclonal antibody targeting GTF3C5 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11447-2-AP targets GTF3C5 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human lung tissue, mouse lung tissue Positive IP detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1999 Product name: Recombinant human GTF3C5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC017337 Sequence: MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANISVHPDKLKVLLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLP Predict reactive species Full Name: general transcription factor IIIC, polypeptide 5, 63kDa Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC017337 Gene Symbol: GTF3C5 Gene ID (NCBI): 9328 RRID: AB_2115258 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5Q8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924