Proteintech, 11456-1-AP, S100A16 Polyclonal antibody

Size: 20ul / 150ul The S100A16 (11456-1-AP) by Proteintech is a Polyclonal antibody targeting S100A16 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 11456-1-AP targets S100A16 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, DU 145 cells, MCF-7 cells Positive IHC detected in: human lung cancer tissue, human bowen disease, human colon cancer tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information S100A16 is a member of the S100 protein family. S100A16 is expressed in a variety of human tissues. S100A16 expression is especially high in tissues rich in epithelial cells. Functionally, S100A16 has been linked to several aspects of tumorigenesis, for example, cell proliferation, differentiation, migration, invasion, and epithelial-mesenchymal transition (EMT).Accordingly, S100A16 has been suggested to have both tumour-promoting and suppressive roles in human cancers. S100A16-mediated cellular functions are suggested to be mediated by the regulation of various signaling pathways/proteins including EMT-related proteins E-cadherin and Vimentin, PI3K-AKT, p53, MMP1-1, MMP-2, MMP-9, JNK/p38, etc. (PMID: 37509106). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2023 Product name: Recombinant human S100A16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC019099 Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS Predict reactive species Full Name: S100 calcium binding protein A16 Calculated Molecular Weight: 103 aa, 12 kDa Observed Molecular Weight: 9-12 kDa GenBank Accession Number: BC019099 Gene Symbol: S100A16 Gene ID (NCBI): 140576 RRID: AB_2269940 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.