Proteintech, 11464-1-AP, COX17 Polyclonal antibody

Size: 20ul / 150ul The COX17 (11464-1-AP) by Proteintech is a Polyclonal antibody targeting COX17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11464-1-AP targets COX17 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, rat heart tissue, THP-1 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2032 Product name: Recombinant human COX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010933 Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI Predict reactive species Full Name: COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) Calculated Molecular Weight: 63 aa, 7 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC010933 Gene Symbol: COX17 Gene ID (NCBI): 10063 RRID: AB_2085109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.