Proteintech, 11469-1-AP, PSMD5 Polyclonal antibody

Size: 20ul / 150ul The PSMD5 (11469-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD5 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11469-1-AP targets PSMD5 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, human liver tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PSMD5, also named as KIAA0072, belongs to the proteasome subunit S5B/HSM3 family. It acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly, it is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a SMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5. (PMID:15489334). This antibody is specific to PSMD5. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2026 Product name: Recombinant human PSMD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-504 aa of BC014478 Sequence: LTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 5 Calculated Molecular Weight: 504 aa, 56 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC014478 Gene Symbol: PSMD5 Gene ID (NCBI): 5711 RRID: AB_2170648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.