Proteintech, 11475-1-AP, MTAP Polyclonal antibody

Size: 20ul / 150ul The MTAP (11475-1-AP) by Proteintech is a Polyclonal antibody targeting MTAP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11475-1-AP targets MTAP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HCT 116 cells, Raji cells, HT-29 cells, HeLa cells, NIH/3T3 cells, C6 cells, mouse heart tissue Positive IHC detected in: human colon cancer tissue, human colon tissue, human liver cancer tissue, mouse heart tissue, mouse skin tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2051 Product name: Recombinant human MTAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC018625 Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Predict reactive species Full Name: methylthioadenosine phosphorylase Calculated Molecular Weight: 283 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC018625 Gene Symbol: MTAP Gene ID (NCBI): 4507 RRID: AB_2147094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13126 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.