Proteintech, 11486-2-AP, APOL1 Polyclonal antibody

Size: 20ul / 150ul The APOL1 (11486-2-AP) by Proteintech is a Polyclonal antibody targeting APOL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11486-2-AP targets APOL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, HepG2 cells, A2780 cells, human plasma, SW 1990 cells, A549 cells, SKOV-3 cells, HeLa cells, MCF-7 cells Positive IP detected in: HepG2 cells, human plasma tissue Positive IHC detected in: human kidney tissue, human liver tissue, human pancreas tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human apolipo-protein L1 (APOL1) is a minor component of plasma high density lipoprotein (HDL) particles, acting as an interacting protein of apolipoprotein A1 (ApoA1). The human ApoL protein family was thought to be predominantly involved in lipid transport and metabolism. APOL1 is also involved in host innate immunity against Trypanosoma parasites. Once activated, APOL1 can lyse the parasite and protect human from infection. Genetic variants in APOL1 gene, which are found in African ancestry with high frequency, associate with chronic kidney disease, like focal segmental glomerulosclerosis (FSGS), HIV-associated nephropathy (HIVAN), and hypertensive nephropathy. APOL1 share structural and functional similarities with proteins of the Bcl-2 family and may has roles in apoptosis and autophagy. It is notable that APOL1 exists only in human and a few other primate species, and mouse does not express an APOL1 orthologue. This antibody recognizes the endogenous APOL1 of 39-45 kDa in blood lysate. Specification Tested Reactivity: human Cited Reactivity: human, trypanosoma brucei Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2016 Product name: Recombinant human APOL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC017331 Sequence: MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA Predict reactive species Full Name: apolipoprotein L, 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC017331 Gene Symbol: APOL1 Gene ID (NCBI): 8542 RRID: AB_2058396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14791 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.