Iright
BRAND / VENDOR: Proteintech

Proteintech, 11491-1-AP, PHACS Polyclonal antibody

CATALOG NUMBER: 11491-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PHACS (11491-1-AP) by Proteintech is a Polyclonal antibody targeting PHACS in WB, IHC, ELISA applications with reactivity to human, mouse samples 11491-1-AP targets PHACS in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MDA-MB-453s cells, HeLa cells, mouse testis tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ACCS(1-aminocyclopropane-1-carboxylate synthase-like protein 1) is also named as PHACS and belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. The deduced 501-amino acid protein has a calculated molecular mass of 58 kD. It contains overlapping aminotransferase I and beta-eliminating lyase domains, and it shares structural similarity with aspartate aminotransferase, tyrosine aminotransferase, and enzymes that catalyze beta-elimination reactions on amino acids. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2056 Product name: Recombinant human ACCS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 152-501 aa of BC020197 Sequence: YCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLLKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRPSQSQEPSDQRR Predict reactive species Full Name: 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) Calculated Molecular Weight: 501 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC020197 Gene Symbol: PHACS Gene ID (NCBI): 84680 RRID: AB_2222681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QU6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924