Proteintech, 11497-1-AP, Apelin Polyclonal antibody

Size: 20ul / 150ul The Apelin (11497-1-AP) by Proteintech is a Polyclonal antibody targeting Apelin in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 11497-1-AP targets Apelin in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human placenta tissue, mouse brain tissue, mouse heart tissue, mouse placenta tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue, mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Apelin, isolated from bovine stomach tissue extractsis, is recognized as the endogenous ligand of the angiotensin-like-receptor 1 (APJ), and the human orphan G-protein-coupled receptor. Apelin is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. Apelin has been found to be a potent stimulator of cardiac contractility and may function in the regulation of the cardiovascular system. Apelin is also known to be involved in the maintenance of INS sensitivity and play an important role in liver disease. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2047 Product name: Recombinant human APLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC021104 Sequence: MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF Predict reactive species Full Name: apelin Calculated Molecular Weight: 77 aa, 9 kDa GenBank Accession Number: BC021104 Gene Symbol: Apelin Gene ID (NCBI): 8862 RRID: AB_2877771 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.