Iright
BRAND / VENDOR: Proteintech

Proteintech, 11499-1-AP, FBXW2 Polyclonal antibody

CATALOG NUMBER: 11499-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXW2 (11499-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11499-1-AP targets FBXW2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The human FBW2 polypeptide contains an N-terminal F-box motif and a C-terminal domain of five WD repeats. A WD repeat is a motif typically consisting of 44-60 amino acids with a signature tryptophan and aspartic acid dipeptide at its C-terminus. The WD repeats in FBW2 recognize GCM1 in a way that is facilitated by GSK3b. Two isoforms were produced by alternative splicing with predicted MW of 52 and 43 kDa according to UniProt, and Catalog#11499-1-AP can recognise both. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2045 Product name: Recombinant human FBXW2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC018738 Sequence: MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCKVKSLLHSPGDYILLSADKYEIKIWPIGREINCKC Predict reactive species Full Name: F-box and WD repeat domain containing 2 Calculated Molecular Weight: 44 kDa, 52 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC018738 Gene Symbol: FBXW2 Gene ID (NCBI): 26190 RRID: AB_2102740 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924