Iright
BRAND / VENDOR: Proteintech

Proteintech, 11511-1-AP, TRIM44 Polyclonal antibody

CATALOG NUMBER: 11511-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRIM44 (11511-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM44 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11511-1-AP targets TRIM44 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human liver tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TRIM44 is one of the family member of TRIM protein, which contains an N-terminal ubiquitin hydrolase-type zinc-finger domain, followed by a coiled-coil domain, a zinc-finger B-box homology domain, and a second coiled-coil domain near the C-terminus. Members of the TRIM protein family are involved in various cellular processes, such as cell proliferation, oncogenesis and antiviral defense. This is a rabbit polyantibody raised against full length of human TRIM44. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2070 Product name: Recombinant human TRIM44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC024031 Sequence: MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEG Predict reactive species Full Name: tripartite motif-containing 44 Calculated Molecular Weight: 344 aa, 38 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC024031 Gene Symbol: TRIM44 Gene ID (NCBI): 54765 RRID: AB_2303802 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924