Proteintech, 11519-1-AP, Symplekin Polyclonal antibody

Size: 20ul / 150ul The Symplekin (11519-1-AP) by Proteintech is a Polyclonal antibody targeting Symplekin in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11519-1-AP targets Symplekin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells Positive IP detected in: K-562 cells Positive IHC detected in: human testis tissue, human colon cancer tissue, human liver tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2081 Product name: Recombinant human SYMPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-478 aa of BC006567 Sequence: MTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRL Predict reactive species Full Name: symplekin Calculated Molecular Weight: 1274 aa, 141 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC006567 Gene Symbol: Symplekin Gene ID (NCBI): 8189 RRID: AB_2200281 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.