Proteintech, 11522-1-AP, TGIF2 Polyclonal antibody

Size: 20ul / 150ul The TGIF2 (11522-1-AP) by Proteintech is a Polyclonal antibody targeting TGIF2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 11522-1-AP targets TGIF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, Daudi cells, HL-60 cells, Jurkat cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Transforming growth factor-beta-induced factor 2(TGIF2), is a member of a subfamily of transcription factor with a TALE(3-amino acid loop extension), an atypical homeodomain. It also contains a proline-rich region, which is a putative SH3 domain-binding site and suggested involve in transcriptional regulation. It is highly expressed in the heart, kidney, and testis, but low in the brain and prostate. Through binding directly to the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins, TGIF2 acts as a transcriptional repressor. The calculated molecular weight of TGIF2 is 26 kDa, but the phosphorylated TGIF2 is about 30-35 kDa protein. This antibody detected two forms of bands of about 28 and 30 kDa, and the upper band appears to result from increased phosphorylation (PMID: 11427533). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2085 Product name: Recombinant human TGIF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC012816 Sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ Predict reactive species Full Name: TGFB-induced factor homeobox 2 Calculated Molecular Weight: 237 aa, 26 kDa Observed Molecular Weight: 28 kDa and 30 kDa GenBank Accession Number: BC012816 Gene Symbol: TGIF2 Gene ID (NCBI): 60436 RRID: AB_2202731 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.