Iright
BRAND / VENDOR: Proteintech

Proteintech, 11545-1-AP, MOXD1 Polyclonal antibody

CATALOG NUMBER: 11545-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MOXD1 (11545-1-AP) by Proteintech is a Polyclonal antibody targeting MOXD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 11545-1-AP targets MOXD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Monooxygenase DBH like 1 (MOXD1) is a member of the copper monooxygenase family, including dopamine monooxygenase (dopamine β-monooxygenase, DBM) and peptidylglycine α-hydroxylating monooxygenase (PHM). MOXD1 is expressed during the development of the neural crest, and distributed along the olfactory bulb, cerebellum, brain stem, and parietal cortex with the development of nerve cells, participating in the basal plate. MOXD1 is highly expressed in GBM cells and can promote the growth of cancer cells (PMID: 35393406). In addition, MOXD1 is a gate-keeper of organ homeostasis and functions as a tumor-suppressor in neuroblastoma Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2060 Product name: Recombinant human MOXD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-613 aa of BC018756 Sequence: MPDAFLTCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNELVLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL Predict reactive species Full Name: monooxygenase, DBH-like 1 Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC018756 Gene Symbol: MOXD1 Gene ID (NCBI): 26002 RRID: AB_10638475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UVY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924