Proteintech, 11553-1-AP, CHRNB1 Polyclonal antibody

Size: 20ul / 150ul The CHRNB1 (11553-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNB1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11553-1-AP targets CHRNB1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Acetylcholine receptors (AChRs) are integral membrane proteins that respond to the binding of acetylcholine (ACh), a neurotransmitter synthesized, stored and finally released by cholinergic neurons. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one each of the beta, delta, and gamma (in immature muscle) or epsilon (in mature muscle) subunits. CHRNB1 gene encodes acetylcholine receptor subunit beta (ACHRB). Mutations in this gene are associated with slow-channel congenital myasthenic syndrome. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2108 Product name: Recombinant human CHRNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-501 aa of BC023553 Sequence: CSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP Predict reactive species Full Name: cholinergic receptor, nicotinic, beta 1 (muscle) Calculated Molecular Weight: 501 aa, 57 kDa Observed Molecular Weight: 50-57 kDa GenBank Accession Number: BC023553 Gene Symbol: CHRNB1 Gene ID (NCBI): 1140 RRID: AB_2291854 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11230 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.