Iright
BRAND / VENDOR: Proteintech

Proteintech, 11567-1-AP, CRLF3 Polyclonal antibody

CATALOG NUMBER: 11567-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CRLF3 (11567-1-AP) by Proteintech is a Polyclonal antibody targeting CRLF3 in WB, ELISA applications with reactivity to human samples 11567-1-AP targets CRLF3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cytokine receptor-like factor 3 (CRLF3), a member of the group 1 in the prototypic class I cytokine receptors, contains the conserved cytokine receptor motif WSXWS, a single transmembrane segment and an intracellular Janus kinase (JAK) docking site (PMID: 31680856). CRLF3 is expressed in most normal human tissues and many tumor cell lines and has been reported to negatively regulate cell cycle progression (PMID: 19427400). CRLF3 has been identified as a human neuroprotective EV-3 (Epo) receptor (PMID: 37168680). It is involved neurogenesis, neuron survival, and dendritic development (PMID: 34233200). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2144 Product name: Recombinant human CRLF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-442 aa of BC023567 Sequence: DSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDSESSGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQAVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHFKLRVTISSNNREVVFDWLLDQSCGSLYFGCSFFYPGWKVLVF Predict reactive species Full Name: cytokine receptor-like factor 3 Calculated Molecular Weight: 442 aa, 50 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC023567 Gene Symbol: CRLF3 Gene ID (NCBI): 51379 RRID: AB_3085377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924