Proteintech, 11588-1-AP, RABL2B Polyclonal antibody

Size: 20ul / 150ul The RABL2B (11588-1-AP) by Proteintech is a Polyclonal antibody targeting RABL2B in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 11588-1-AP targets RABL2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, HepG2 cells, human brain tissue, human heart tissue, human kidney tissue, human liver tissue, mouse brain tissue Positive IP detected in: fetal human brain tissue Positive IHC detected in: mouse kidney tissue, human lung cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Rab-like protein 2B (RABL2B) is a member of a poorly characterised clade of the RAS GTPase superfamily, which plays an essential role in male fertility, sperm intraflagellar transport and tail assembly (PMID: 28553998, PMID: 28138870). A preferential expression of RABL2B in human tissues and lymphoblastoid cell lines was detected which is most pronounced in brain and placenta (PMID: 20138207). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2189 Product name: Recombinant human RABL2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC024281 Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS Predict reactive species Full Name: RAB, member of RAS oncogene family-like 2B Calculated Molecular Weight: 229 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC024281 Gene Symbol: RABL2B Gene ID (NCBI): 11158 RRID: AB_2175954 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.