Proteintech, 11606-1-AP, TAC3 Polyclonal antibody

Size: 20ul / 150ul The TAC3 (11606-1-AP) by Proteintech is a Polyclonal antibody targeting TAC3 in WB, ELISA applications with reactivity to human samples 11606-1-AP targets TAC3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2156 Product name: Recombinant human TAC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC032145 Sequence: MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE Predict reactive species Full Name: tachykinin 3 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC032145 Gene Symbol: TAC3 Gene ID (NCBI): 6866 RRID: AB_3669128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.