Iright
BRAND / VENDOR: Proteintech

Proteintech, 11611-2-AP, CDR2 Polyclonal antibody

CATALOG NUMBER: 11611-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDR2 (11611-2-AP) by Proteintech is a Polyclonal antibody targeting CDR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11611-2-AP targets CDR2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue, Y79 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Patients with paraneoplastic cerebellar degeneration (PCD) carry a characteristic antibody called anti-Yo. On Western blot analysis of Purkinje cells and tumor tissue from CD patient, the anti-Yo sera react with at least 2 antigens, a major species of 62 kD called CDR62 or CDR2 [PMID:18045792]. CDR2 is partly characterized, as CDR2 through its leucine zipper motif has been demonstrated to interact with c-myc, with cell cycle-related proteins and with a protein kinase, indicating that CDR2 is involved in signal transduction and gene transcription. Furthermore, CDR2 has been found to attenuate hypoxic response in renal cell carcinoma, and recent data suggest a role for CDR2 and c-myc in mitosis in cycling cells [PMID:21080165]. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2183 Product name: Recombinant human CDR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-454 aa of BC017503 Sequence: SKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS Predict reactive species Full Name: cerebellar degeneration-related protein 2, 62kDa Calculated Molecular Weight: 454 aa, 52 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC017503 Gene Symbol: CDR2 Gene ID (NCBI): 1039 RRID: AB_2076734 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01850 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924