Iright
BRAND / VENDOR: Proteintech

Proteintech, 11624-1-AP, UHMK1 Polyclonal antibody

CATALOG NUMBER: 11624-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UHMK1 (11624-1-AP) by Proteintech is a Polyclonal antibody targeting UHMK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11624-1-AP targets UHMK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UHMK1, also named as KIS, or KIST, is a 419 amino acid protein, which contains one RRM (RNA recognition motif) domain, one protein kinase domain, and belongs to the protein kinase superfamily. UHMK1 is widely expressed, with highest levels in skeletal muscle, kidney, placenta and peripheral blood leukocytes. UHMK1 localizes in the nucleus and upon serum stimulation, phosphorylating CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. UHMK1 may be involved in trafficking and/or processing of RNA and may have a role in the developing nervous system and the adult brain. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2204 Product name: Recombinant human UHMK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-344 aa of BC026046 Sequence: GSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSATIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEGLC Predict reactive species Full Name: U2AF homology motif (UHM) kinase 1 Calculated Molecular Weight: 419 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC026046 Gene Symbol: UHMK1 Gene ID (NCBI): 127933 RRID: AB_2214267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAS1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924