Iright
BRAND / VENDOR: Proteintech

Proteintech, 11636-1-AP, MND1 Polyclonal antibody

CATALOG NUMBER: 11636-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MND1 (11636-1-AP) by Proteintech is a Polyclonal antibody targeting MND1 in WB, IP, ELISA applications with reactivity to human, mouse samples 11636-1-AP targets MND1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, human lung tissue, human kidney tissue, human liver tissue, MCF-7 cells Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2210 Product name: Recombinant human MND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC032142 Sequence: MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID Predict reactive species Full Name: meiotic nuclear divisions 1 homolog (S. cerevisiae) Calculated Molecular Weight: 205 aa, 24 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC032142 Gene Symbol: MND1 Gene ID (NCBI): 84057 RRID: AB_2266545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924