Iright
BRAND / VENDOR: Proteintech

Proteintech, 11649-2-AP, EIF1AX Polyclonal antibody

CATALOG NUMBER: 11649-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EIF1AX (11649-2-AP) by Proteintech is a Polyclonal antibody targeting EIF1AX in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11649-2-AP targets EIF1AX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, HEK-293T cells, Jurkat cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Eukaryotic translation initiation factor 1A, X-chromosome(EIF1AX), designated as to distinguish from the Y-linked homolog, has an unblocked N-terminal proline, which was consistent with the general pattern of eukaryotic protein. It's may be required for maximal rate of protein biosynthesis. Like EIF4C, it enhances ribosome dissociation into subunits and stabilizeds the binding of the initiator Met-tRNA(l) to 40S ribosomal subunits. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2248 Product name: Recombinant human EIF1AX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC000793 Sequence: MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI Predict reactive species Full Name: eukaryotic translation initiation factor 1A, X-linked Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC000793 Gene Symbol: EIF1AX Gene ID (NCBI): 1964 RRID: AB_2097803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924