Iright
BRAND / VENDOR: Proteintech

Proteintech, 11653-1-AP, AP4M1 Polyclonal antibody

CATALOG NUMBER: 11653-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AP4M1 (11653-1-AP) by Proteintech is a Polyclonal antibody targeting AP4M1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11653-1-AP targets AP4M1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, HeLa cells, mouse lung tissue, A431 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Adaptor protein (AP) complex is a component of intracellular protein transport. The AP4 complex is involved in sorting transmembrane cargo proteins into transport vesicles for trans-Golgi network export. AP4M1 is a member of the AP4 complex, which also includes AP4B1, AP4E1, and AP4S1. Loss-of-function variants in any of these four members can lead to AP-4-associated hereditary spastic paraplegia (HSP), a neurodegenerative disorder (PMID: 30543385). This antibody recognizes AP4M1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2222 Product name: Recombinant human AP4M1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-453 aa of BC018705 Sequence: GSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI Predict reactive species Full Name: adaptor-related protein complex 4, mu 1 subunit Calculated Molecular Weight: 453 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC018705 Gene Symbol: AP4M1 Gene ID (NCBI): 9179 RRID: AB_2227267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00189 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924