Proteintech, 11673-1-AP, ARF4 Polyclonal antibody

Size: 20ul / 150ul The ARF4 (11673-1-AP) by Proteintech is a Polyclonal antibody targeting ARF4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 11673-1-AP targets ARF4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, HeLa cells, HepG2 cells, K-562 cells, mouse brain tissue, rat brain tissue Positive IP detected in: HepG2 cells, mouse brain tissue Positive IHC detected in: human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ARF4, also named as ARF2, belongs to the small GTPase superfamily and Arf family. ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF4 and ARF5 are class II ARFs. Their function are not fully described. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2272 Product name: Recombinant human ARF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC003364 Sequence: MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR Predict reactive species Full Name: ADP-ribosylation factor 4 Calculated Molecular Weight: 180 aa, 21 kDa Observed Molecular Weight: 16 kDa, 21 kDa GenBank Accession Number: BC003364 Gene Symbol: ARF4 Gene ID (NCBI): 378 RRID: AB_2058463 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18085 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.