Proteintech, 11678-1-AP, ARPP-19 Polyclonal antibody

Size: 20ul / 150ul The ARPP-19 (11678-1-AP) by Proteintech is a Polyclonal antibody targeting ARPP-19 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11678-1-AP targets ARPP-19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, A375 cells, A549 cells, mouse brain tissue, rat skeletal muscle tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information ARPP-19, a 19-kDa cAMP-regulated phosphoprotein, plays a role in regulating mitosis. Initiation and maintenance of mitosis require the activation of protein kinase cyclin B-Cdc2 and the inhibition of protein phosphatase 2A (PP2A). When phosphorylated by protein kinase Greatwall (Gwl), ARPP-19 associate with and inhibit PP2A, thus promoting mitotic entry. ARPP-19 may be an important link between nerve growth factor (NGF) signaling and post-transcriptional control of neuronal gene expression such as GAP-43. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2279 Product name: Recombinant human ARPP-19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC003418 Sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG Predict reactive species Full Name: cyclic AMP phosphoprotein, 19 kD Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC003418 Gene Symbol: ARPP-19 Gene ID (NCBI): 10776 RRID: AB_2060078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56211 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.