Proteintech, 11692-1-AP, TAX1BP3 Polyclonal antibody

Size: 20ul / 150ul The TAX1BP3 (11692-1-AP) by Proteintech is a Polyclonal antibody targeting TAX1BP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11692-1-AP targets TAX1BP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human colon tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tax-interacting protein 1 (TIP-1, also known as Tax1bp3 or glutaminase-interacting protein, GIP) is unique in its simple structure, a single PDZ domain is the only functional and structural unit identified so far in this small PDZ protein (124 amino acids in human and mouse). High level of TIP-1 expression was detected in human invasive breast cancer cells and that is important for tumor cell adhesion, migration and pulmonary metastasis. However, the precise biological effects of TIP-1 and its functional mechanisms have largely remained elusive. Mutation of TAX1BP3 can cause Dilated Cardiomyopathy with Septo-Optic Dysplasia (PMID: 25645515). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2306 Product name: Recombinant human TAX1BP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC023980 Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS Predict reactive species Full Name: Tax1 (human T-cell leukemia virus type I) binding protein 3 Calculated Molecular Weight: 124 aa, 14 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC023980 Gene Symbol: TAX1BP3 Gene ID (NCBI): 30851 RRID: AB_11182823 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14907 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.