Proteintech, 11694-1-AP, ARL5B Polyclonal antibody

Size: 20ul / 150ul The ARL5B (11694-1-AP) by Proteintech is a Polyclonal antibody targeting ARL5B in WB, IHC, ELISA applications with reactivity to human samples 11694-1-AP targets ARL5B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HepG2 cells, HeLa cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ARL5B, also known as ADP ribosylation factor-like GTPase 5B, is a small G protein that is localized to the trans-Golgi network (TGN) in mammalian cells. It plays a significant role in the regulation of retrograde membrane transport from endosomes back to the TGN. This function is particularly important for the maintenance of cellular membrane traffic and the organization of the Golgi apparatus. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2309 Product name: Recombinant human ARL5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC024163 Sequence: MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR Predict reactive species Full Name: ADP-ribosylation factor-like 5B Calculated Molecular Weight: 179 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC024163 Gene Symbol: ARL5B Gene ID (NCBI): 221079 RRID: AB_2058835 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.