Proteintech, 11752-1-AP, TWIST2 Polyclonal antibody

Size: 20ul / 150ul The TWIST2 (11752-1-AP) by Proteintech is a Polyclonal antibody targeting TWIST2 in WB, ELISA applications with reactivity to human, mouse samples 11752-1-AP targets TWIST2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, MCF-7 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TWIST2, also named as BHLHA39 and DERMO1,is a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. TWIST2 inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors. It is also implicated in tumorigenesis, invasion and metastasis. TWIST2 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2348 Product name: Recombinant human TWIST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC033168 Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH Predict reactive species Full Name: twist homolog 2 (Drosophila) Calculated Molecular Weight: 160 aa, 18 kDa Observed Molecular Weight: 21 kDa, 60 kDa GenBank Accession Number: BC033168 Gene Symbol: TWIST2 Gene ID (NCBI): 117581 RRID: AB_2877791 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.