Proteintech, 11758-1-AP, HFE2/Hemojuvelin Polyclonal antibody

Size: 20ul / 150ul The HFE2/Hemojuvelin (11758-1-AP) by Proteintech is a Polyclonal antibody targeting HFE2/Hemojuvelin in WB, ELISA applications with reactivity to human, mouse, rat samples 11758-1-AP targets HFE2/Hemojuvelin in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, rat heart tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information HFE2, also known as Hemojuvelin (HJV), is a GPI-anchored protein that binds to new proteins and bone morphogenetic proteins (BMP2 and BMP4) and can be released from the cell membrane. HFE2 plays a key role in the regulation of hepcidin, which regulates the absorption and recycling of iron.(PMID: 17331953; PMID: 17938254) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2354 Product name: Recombinant human HFE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-426 aa of BC017926 Sequence: MQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ Predict reactive species Full Name: hemochromatosis type 2 (juvenile) Calculated Molecular Weight: 426 aa, 45 kDa Observed Molecular Weight: 23 kDa, 38 kDa, 45-50 kDa GenBank Accession Number: BC017926 Gene Symbol: HFE2 Gene ID (NCBI): 148738 RRID: AB_2877792 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZVN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.