Iright
BRAND / VENDOR: Proteintech

Proteintech, 11763-1-AP, ENOPH1 Polyclonal antibody

CATALOG NUMBER: 11763-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ENOPH1 (11763-1-AP) by Proteintech is a Polyclonal antibody targeting ENOPH1 in WB, ELISA applications with reactivity to human samples 11763-1-AP targets ENOPH1 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2360 Product name: Recombinant human ENOPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC001317 Sequence: MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST Predict reactive species Full Name: enolase-phosphatase 1 Calculated Molecular Weight: 13 kDa / 29 kDa Observed Molecular Weight: 29-35 kDa GenBank Accession Number: BC001317 Gene Symbol: ENOPH1 Gene ID (NCBI): 58478 RRID: AB_10794441 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924