Proteintech, 11768-1-AP, PANK1 Polyclonal antibody

Size: 20ul / 150ul The PANK1 (11768-1-AP) by Proteintech is a Polyclonal antibody targeting PANK1 in WB, ELISA applications with reactivity to human, mouse, rat samples 11768-1-AP targets PANK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, SW 1990 cells, HeLa cells, human heart tissue, MCF-7 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information PANK1(Pantothenate kinase 1) is also named as PANk and belongs to the type II pantothenate kinase family. The PANK1 protein, which catalyzes the rate-limiting step of coenzyme A biosynthesis, is also upregulated by p53(PMID:20833636). It also catalyzes the cytosolic phosphorylation of pantothenate (vitamin B5) and derivatives. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 64 kDa, 42 kDa, 36kDa and 45 kDa,respectively. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2324 Product name: Recombinant human PANK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 462-598 aa of BC026296 Sequence: MAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK Predict reactive species Full Name: pantothenate kinase 1 Calculated Molecular Weight: 598 aa, 64 kDa Observed Molecular Weight: 61-64 kDa, 40-45 kDa GenBank Accession Number: BC026296 Gene Symbol: PANK1 Gene ID (NCBI): 53354 RRID: AB_2158913 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TE04 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.