Proteintech, 11775-1-AP, FCN1 Polyclonal antibody

Size: 20ul / 150ul The FCN1 (11775-1-AP) by Proteintech is a Polyclonal antibody targeting FCN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 11775-1-AP targets FCN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma, K-562 cells, human liver tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2444 Product name: Recombinant human FCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC020635 Sequence: MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA Predict reactive species Full Name: ficolin (collagen/fibrinogen domain containing) 1 Calculated Molecular Weight: 326 aa, 35 kDa Observed Molecular Weight: 33-37 kDa GenBank Accession Number: BC020635 Gene Symbol: FCN1 Gene ID (NCBI): 2219 RRID: AB_2104288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.