Proteintech, 11776-1-AP, NAMPT/PBEF Polyclonal antibody

Size: 20ul / 150ul The NAMPT/PBEF (11776-1-AP) by Proteintech is a Polyclonal antibody targeting NAMPT/PBEF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, zebrafish samples 11776-1-AP targets NAMPT/PBEF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples. Tested Applications Positive WB detected in: rat liver tissue, HL-60 cells, MCF-7 cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, Ramos cells, RAW 264.7 cells Positive IP detected in: mouse heart tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, HeLa cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism. Specification Tested Reactivity: human, mouse, rat, zebrafish Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2434 Product name: Recombinant human NAMPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC020691 Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV Predict reactive species Full Name: nicotinamide phosphoribosyltransferase Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC020691 Gene Symbol: NAMPT/PBEF Gene ID (NCBI): 10135 RRID: AB_2298317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43490 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.