Iright
BRAND / VENDOR: Proteintech

Proteintech, 11814-1-AP, RFC3 Polyclonal antibody

CATALOG NUMBER: 11814-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RFC3 (11814-1-AP) by Proteintech is a Polyclonal antibody targeting RFC3 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11814-1-AP targets RFC3 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, HeLa cells, human heart tissue Positive IP detected in: HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RFC3, also known as RFC38, is a 356 amino acid protein, which localizes in nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase . In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3 and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion and metastasis. RFC3 exists two isoforms with molecular weight of 34 kDa and 38-40 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2269 Product name: Recombinant human RFC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-356 aa of BC000149 Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF Predict reactive species Full Name: replication factor C (activator 1) 3, 38kDa Calculated Molecular Weight: 40 aa, 6 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000149 Gene Symbol: RFC3 Gene ID (NCBI): 5983 RRID: AB_2178470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40938 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924