Proteintech, 11821-1-AP, ANKRD2 Polyclonal antibody

Size: 20ul / 150ul The ANKRD2 (11821-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11821-1-AP targets ANKRD2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human skeletal muscle tissue, mouse skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human kidney tissue, human lung tissue, human skeletal muscle tissue, human testis tissue, human brain tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy. Together with Ankrd1/CARP and DARP, ANKRD2 are members of the MARP mechanosensing proteins that form a complex with titin (N2A)/calpain 3 protease/myopalladin. Ankrd2 is thought to have dual, structural and signaling roles, and could link the elastic I-band region as a stress sensor for transcriptional control in the nucleus Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2389 Product name: Recombinant human ANKRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC020817 Sequence: EAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ Predict reactive species Full Name: ankyrin repeat domain 2 (stretch responsive muscle) Calculated Molecular Weight: 37 aa, 2 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC020817 Gene Symbol: ANKRD2 Gene ID (NCBI): 26287 RRID: AB_2057858 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.