Product Description
Size: 20ul / 150ul
The VAMP5 (11822-1-AP) by Proteintech is a Polyclonal antibody targeting VAMP5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
11822-1-AP targets VAMP5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: human lung tissue, mouse kidney tissue, Human peripheral blood leukocyte cells
Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
VAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2390 Product name: Recombinant human VAMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC017891 Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN Predict reactive species
Full Name: vesicle-associated membrane protein 5 (myobrevin)
Calculated Molecular Weight: 12.8 kDa
Observed Molecular Weight: 13-15 kDa
GenBank Accession Number: BC017891
Gene Symbol: VAMP5
Gene ID (NCBI): 10791
RRID: AB_2212965
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95183
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924