Iright
BRAND / VENDOR: Proteintech

Proteintech, 11828-1-AP, EMCN Polyclonal antibody

CATALOG NUMBER: 11828-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EMCN (11828-1-AP) by Proteintech is a Polyclonal antibody targeting EMCN in WB, ELISA applications with reactivity to human, mouse samples 11828-1-AP targets EMCN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Endomucin (EMCN), also known as Endomucin 2 or Mucin 14, is a type I integral membrane glycoprotein that is endothelial-specific. EMCN is expressed on the surface of capillaries and venous and is highly expressed in highly vascularized tissues such as heart, kidney and lung (PMID: 29215001). Endomucin plays an important role in cell interaction, molecular cell signaling, angiogenesis and cell migration (PMID: 33532708). Since it is glycosylated, the apparent molecular weight of EMCN could be variable, ranging from 80 kDa to 120 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2396 Product name: Recombinant human EMCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC017781 Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN Predict reactive species Full Name: endomucin Calculated Molecular Weight: 19 kDa, 27 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC017781 Gene Symbol: EMCN Gene ID (NCBI): 51705 RRID: AB_3085382 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924