Iright
BRAND / VENDOR: Proteintech

Proteintech, 11830-1-AP, FBXO6 Polyclonal antibody

CATALOG NUMBER: 11830-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXO6 (11830-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO6 in IHC, ELISA applications with reactivity to human, mouse samples 11830-1-AP targets FBXO6 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBXO6(F-box only protein 6 ) is also named as FBG2, FBS2, FBX6 and belongs to the F-box protein family. It can regulate Chk1 ubiquitination and degradation in both normally cycling cells and during replication stress. This protein is mainly detected in the cytoplasm in both cultured cells and in tumor tissues. Its expression is a predictive biomarker of tumor responsiveness to the important anticancer drugs.(PMID:19716789). FBXO6 can inhibit the anaphase promoting complex (cyclosome APC) and prevent mitotic exit in cytostatic factor (CSF) arrested eggs as a mitotic regulator. The observed molecular size of FBXO6 is around 40 kda, which might be due to the ubiquitination modification of FBXO6. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2400 Product name: Recombinant human FBXO6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC020880 Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF Predict reactive species Full Name: F-box protein 6 Calculated Molecular Weight: 293 aa, 34 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC020880 Gene Symbol: FBXO6 Gene ID (NCBI): 26270 RRID: AB_2104709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924