Proteintech, 11845-1-AP, SRPX2 Polyclonal antibody

Size: 20ul / 150ul The SRPX2 (11845-1-AP) by Proteintech is a Polyclonal antibody targeting SRPX2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 11845-1-AP targets SRPX2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, human kidney tissue, human brain tissue, HepG2 cells Positive IHC detected in: human placenta tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SRPX2 (sushi-repeat-containing protein, X-linked 2) is a secreted protein expressed in neurons of the human adult brain, including the rolandic area (PMID: 20874700). Firstly described as sushi-repeat protein up-regulated in leukemia (SPRUL) in leukemia cells with dysregulated expression at the transcriptional level, SRPX2 has been recently shown as a multifunctional protein. SRPX2 is a ligand for uPAR, the urokinase-type plasminogen activator (uPA) receptor (PMID: 18718938). It is involved in seizure disorders, angiogenesis and cellular adhesion (PMID: 22242148; 19667118; 16497722). The involvement of SRPX2 in disorders of language cortex and cognition suggests it has an important role in the perisylvian region critical for language development (PMID: 16497722). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2516 Product name: Recombinant human SRPX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-465 aa of BC020733 Sequence: DGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGASCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE Predict reactive species Full Name: sushi-repeat-containing protein, X-linked 2 Calculated Molecular Weight: 465 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC020733 Gene Symbol: SRPX2 Gene ID (NCBI): 27286 RRID: AB_2195006 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.