Proteintech, 11861-1-AP, RAMP3 Polyclonal antibody

Size: 20ul / 150ul The RAMP3 (11861-1-AP) by Proteintech is a Polyclonal antibody targeting RAMP3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11861-1-AP targets RAMP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, human kidney tissue, Jurkat cells, mouse pancreas tissue, human placenta tissue, mouse brain tissue, mouse heart tissue, mouse skeletal muscle tissue, human heart tissue, mouse lung tissue, MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated 58-kD CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2438 Product name: Recombinant human RAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC022304 Sequence: METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL Predict reactive species Full Name: receptor (G protein-coupled) activity modifying protein 3 Calculated Molecular Weight: 16.5 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC022304 Gene Symbol: RAMP3 Gene ID (NCBI): 10268 RRID: AB_2176465 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60896 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.