Proteintech, 11866-1-AP, RGS18 Polyclonal antibody

Size: 20ul / 150ul The RGS18 (11866-1-AP) by Proteintech is a Polyclonal antibody targeting RGS18 in WB, ELISA applications with reactivity to human samples 11866-1-AP targets RGS18 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2445 Product name: Recombinant human RGS18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC020632 Sequence: METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL Predict reactive species Full Name: regulator of G-protein signaling 18 Calculated Molecular Weight: 235 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC020632 Gene Symbol: RGS18 Gene ID (NCBI): 64407 RRID: AB_2877800 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS28 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.