Proteintech, 11868-1-AP, SH2D1A Polyclonal antibody

Size: 20ul / 150ul The SH2D1A (11868-1-AP) by Proteintech is a Polyclonal antibody targeting SH2D1A in WB, ELISA applications with reactivity to human, mouse, rat samples 11868-1-AP targets SH2D1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SH2D1A, also named as DSHP and SAP, is an inhibitor of the SLAM self-association. It acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. SH2D1A mediates interaction between FYN and SLAMF1. Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2450 Product name: Recombinant human SH2D1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC020732 Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP Predict reactive species Full Name: SH2 domain protein 1A Calculated Molecular Weight: 128 aa, 14 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC020732 Gene Symbol: SH2D1A Gene ID (NCBI): 4068 RRID: AB_2239283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60880 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.