Iright
BRAND / VENDOR: Proteintech

Proteintech, 11900-1-AP, DGKE Polyclonal antibody

CATALOG NUMBER: 11900-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DGKE (11900-1-AP) by Proteintech is a Polyclonal antibody targeting DGKE in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11900-1-AP targets DGKE in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DGKE(Diacylglycerol kinase epsilon) is also named as DAGK5 and belongs to the eukaryotic diacylglycerol kinase family.It may be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction(PMID:16689942).When expressed in mammalian cells, DGK-epsilon showed specificity for arachidonyl-containing diacylglycerol. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2512 Product name: Recombinant human DGKE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC022297 Sequence: MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV Predict reactive species Full Name: diacylglycerol kinase, epsilon 64kDa Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 60-64 kDa GenBank Accession Number: BC022297 Gene Symbol: DGKE Gene ID (NCBI): 8526 RRID: AB_2091145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52429 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924