Proteintech, 11925-1-AP, AP3M2 Polyclonal antibody

Size: 20ul / 150ul The AP3M2 (11925-1-AP) by Proteintech is a Polyclonal antibody targeting AP3M2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11925-1-AP targets AP3M2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, Hacat cells (siRNA) Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information AP3M2 is a 47-kDa protein that belongs to the adaptor complexes medium subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3M2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. AP-3 is implicated in the transport of lysosomal membrane proteins. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2572 Product name: Recombinant human AP3M2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC056257 Sequence: MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQKCCLGM Predict reactive species Full Name: adaptor-related protein complex 3, mu 2 subunit Calculated Molecular Weight: 418 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC056257 Gene Symbol: AP3M2 Gene ID (NCBI): 10947 RRID: AB_10640438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53677 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.