Proteintech, 11942-1-AP, PKIB Polyclonal antibody

Size: 20ul / 150ul The PKIB (11942-1-AP) by Proteintech is a Polyclonal antibody targeting PKIB in IHC, ELISA applications with reactivity to human, mouse samples 11942-1-AP targets PKIB in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human stomach cancer tissue, human gliomas tissue, mouse kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The cAMP-dependent protein kinase inhibitor-β (PKIB) is also named as PRKACN2. PKIB is presumed to be one of the regulatory factors controlling the cAMP-dependent protein kinase A signaling pathway (PMID: 23224602). PKIB plays an important role in regulating the proliferation, migration, and even metastasis of osteosarcoma (PMID: 17195088). The expression of PKIB in the cytoplasm of tumor is closely related to pAkt and the triple negative breast cancer (PMID: 28387904). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2541 Product name: Recombinant human PKIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC036011 Sequence: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK Predict reactive species Full Name: protein kinase (cAMP-dependent, catalytic) inhibitor beta Calculated Molecular Weight: 78 aa, 9 kDa GenBank Accession Number: BC036011 Gene Symbol: PKIB Gene ID (NCBI): 5570 RRID: AB_3085384 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C010 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.