Proteintech, 11954-1-AP, DYNLT1 Polyclonal antibody

Size: 20ul / 150ul The DYNLT1 (11954-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLT1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 11954-1-AP targets DYNLT1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, HEK-293 cells, human heart tissue, Sp2/0 cells Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:300-1:600 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (Pubmed: 19448628) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2557 Product name: Recombinant human DYNLT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC029412 Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI Predict reactive species Full Name: dynein, light chain, Tctex-type 1 Calculated Molecular Weight: 113 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC029412 Gene Symbol: DYNLT1 Gene ID (NCBI): 6993 RRID: AB_2230661 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.