Iright
BRAND / VENDOR: Proteintech

Proteintech, 11958-1-AP, PCBD2 Polyclonal antibody

CATALOG NUMBER: 11958-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PCBD2 (11958-1-AP) by Proteintech is a Polyclonal antibody targeting PCBD2 in WB, ELISA applications with reactivity to human samples 11958-1-AP targets PCBD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PCBD2(Pterin-4-alpha-carbinolamine dehydratase 2) is also named DCOH2, DCOHM and belongs to the pterin-4-alpha-carbinolamine dehydratase family. It is involved in tetrahydrobiopterin biosynthesis and it seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. PCBD2 also regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2562 Product name: Recombinant human PCBD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC054021 Sequence: MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV Predict reactive species Full Name: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 Calculated Molecular Weight: 130 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC054021 Gene Symbol: PCBD2 Gene ID (NCBI): 84105 RRID: AB_2877806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0N5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924