Proteintech, 11966-1-AP, FXYD4 Polyclonal antibody

Size: 20ul / 150ul The FXYD4 (11966-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD4 in IHC, ELISA applications with reactivity to human, mouse samples 11966-1-AP targets FXYD4 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human renal cell carcinoma tissue, mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2576 Product name: Recombinant human FXYD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC054876 Sequence: MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTC Predict reactive species Full Name: FXYD domain containing ion transport regulator 4 Calculated Molecular Weight: 89 aa, 10 kDa GenBank Accession Number: BC054876 Gene Symbol: FXYD4 Gene ID (NCBI): 53828 RRID: AB_2108604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P59646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.