Iright
BRAND / VENDOR: Proteintech

Proteintech, 11973-1-AP, TIMM13 Polyclonal antibody

CATALOG NUMBER: 11973-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TIMM13 (11973-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM13 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11973-1-AP targets TIMM13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TIMM13 gene, also known as TIM13, TIM13B, TIM M13A or TIMM13B, encodes mitochondrial import inner membrane translocase subunit Tim13 belonging to the small Tim family. TIM13 functions as mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Proteins of the intermembrane space (IMS) of mitochondria are typically synthesized without presequences. TIM13 contains four conserved cysteine residues that bind a zinc ion as cofactor. Import of TIM13 did not depend on the membrane potential or ATP hydrolysis. Upon import into mitochondria TIM13 adopted a stably folded conformation in the IMS. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2596 Product name: Recombinant human TIMM13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC008607 Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM Predict reactive species Full Name: translocase of inner mitochondrial membrane 13 homolog (yeast) Calculated Molecular Weight: 95 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC008607 Gene Symbol: TIMM13 Gene ID (NCBI): 26517 RRID: AB_2287228 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5L4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924