Iright
BRAND / VENDOR: Proteintech

Proteintech, 11978-2-AP, GNB4 Polyclonal antibody

CATALOG NUMBER: 11978-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GNB4 (11978-2-AP) by Proteintech is a Polyclonal antibody targeting GNB4 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11978-2-AP targets GNB4 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, MCF-7 cells, SH-SY5Y cells, human placenta tissue, mouse kidney tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: SH-SY5Y cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information G protein subunit beta 4 (GNB4), is one of the heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins. GNB4 is important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2604 Product name: Recombinant human GNB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC000873 Sequence: MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 4 Calculated Molecular Weight: 340 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000873 Gene Symbol: GNB4 Gene ID (NCBI): 59345 RRID: AB_2109620 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924